Review



neurocult sm1 without vitamin a stemcell #05731  (STEMCELL Technologies Inc)

 
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 90
      Buy from Supplier

    Structured Review

    STEMCELL Technologies Inc neurocult sm1 without vitamin a stemcell #05731
    Neurocult Sm1 Without Vitamin A Stemcell #05731, supplied by STEMCELL Technologies Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/neurocult+sm1+stemcell/neurocult+sm1+without+vitamin+a/pmc11497635-49-11-16
    Average 90 stars, based on 1 article reviews
    neurocult sm1 without vitamin a stemcell #05731 - by Bioz Stars, 2026-10
    90/100 stars

    Images

    Related Articles

    Recombinant:

    Article Title: Ketamine alleviates NMDA receptor hypofunction through synaptic trapping.
    Article Snippet: .. REAGENT or RESOURCE SOURCE IDENTIFIER Antibodies Anti-GFP polyclonal antibody (rabbit) ThermoFisher Scientific Cat# A-6455 Anti-GluN1 polyclonal antibody (rabbit) Alomone Labs Cat# AGC-001 Anti-KV1.3 polyclonal antibody (rabbit) Alomone Labs Cat# APC-101 Anti-EphB2R polyclonal antibody (goat) R&D systems Cat# AF467 Anti-Flag polyclonal antibody (rabbit) Sigma-Aldrich Cat# F2555 Anti-Flag M2 monoclonal antibody (mouse) Sigma-Aldrich Cat# F1804 Anti-GluN2B polyclonal antibody (rabbit) Alomone Labs Cat# AGC-003 Anti-GluN2B polyclonal antibody (rabbit) Homemade8 N/A Anti-Homer1 polyclonal antibody (guinea pig) Synaptic Systems #AB 10549720 Anti-GFP polyclonal antibody (mouse) Roche Cat# 11814460001 Alexa 594-conjugated anti-guinea pig (goat) Jackson ImmunoResearch #AB_2337442 Alexa 488-conjugated anti-mouse secondary antibody (goat) ThermoFisher Scientific CAT#A28175 Alexa Fluor 647-conjugated anti-mouse IgG (donkey) ThermoFisher Scientific Cat# A31571 Qdot 655-conjugated anti-rabbit IgG (goat) ThermoFisher Scientific Cat# Q11422MP Qdot 655-conjugated anti-goat IgG (rabbit) ThermoFisher Scientific Cat# Q11821MP Chemicals, peptides, and recombinant proteins Buprenorphine Axience Buprecare (0.3 mg/ml) Meloxicam Boehringer Ingelheim Animal Health France Metacam (0.5 mg/m) Ketamine hydrochloride Virbac Ketamine 1000 (100 mg/ml) D-AP5 Tocris Bioscience Cat# 0106 (+)-MK-801 maleate Tocris Bioscience Cat# 0924 Memantine hydrochloride Tocris Bioscience Cat# 0773 (RS)-CPP Tocris Bioscience Cat# 0173 Kynurenic acid Sigma-Aldrich Cat# K3375 NMDA Sigma-Aldrich Cat# M3262 Poly-L-lysine Sigma-Aldrich Cat# P4707 Horse serum ThermoFisher Scientific Waltham, MA, USA, ref. N 26050-88 Bovine serum albumin (BSA) Sigma-Aldrich Cat #A3059 Fluoromount-G mounting medium containing DAPI ThermoFisher Scientific Cat #00-4959-52 Mowiol mounting medium Sigma-Aldrich Ref. #475904 Poly-L-lysine Sigma-Aldrich Ref. #P26361G Neurobasal medium/B27 ThermoFisher Scientific Ref. #12348-017/A3582901 NeuroCult SM1 Stemcell technologies CAT05711 BrainPhys medium Stemcell technologies CAT#05790 Leibovitz’s L-15 medium ThermoFisher Scientific CAT#11415064 Hank’s Balanced Salt Solution ThermoFisher Scientific Ref. #25300-054 Glycerol 24% Sigma-Aldrich Ref. #G5516 Tris-Cl Sigma-Aldrich CAT#15,456-3 TetraSpeck microspheres ThermoFisher Scientific Cat# T7279 Biomimetic TAT-2B peptide (YGRKKRRQRRRNGHVYEKLSSIESDV) CASLO ApS N/A Non-sense TAT-NS peptide (YGRKKRRQRRRGSEVILDQPVIAKPLIPALSVALSVKEEA) CASLO ApS N/A (Continued on next page) Neuron 112, 1–18.e1–e9, October 9, 2024 e1 .. REAGENT or RESOURCE SOURCE IDENTIFIER Recombinant DNA Plasmid to express mEos3.2-GluN1 (pRcCMV-mEos3.2-GluN1) Homemade (this paper) N/A Plasmid to express GFP-Homer1c (pcDNA3.1-EGFP-Homer1c) Homemade35 N/A Plasmid to express dimeric DsRed-Homer1c (pcDNA3.1-dimeric_DsRed-Homer1c) Homemade35 N/A Plasmid to express GluN1-mCherry (pCMV-GluN1-mCherry) Gift from P. de Koninck30 N/A Plasmid to express GluN1-mGFP (pCMV-GluN1-mGFP) Gift from P. de Koninck32 N/A Plasmid to express GluN1-N616A-mGFP (pCMV-GluN1-N616A-mGFP) Homemade (this paper) N/A Plasmid to express GluN1-N616A-mCherry (pCMV-GluN1-N616A-mCherry) Homemade (this paper) N/A Plasmid to express Flag-GluN1 (pCMV-Flag-GluN1) Homemade35 N/A Plasmid to express Flag-GluN2B (pCMV-Flag-GluN2B) Gift from R. Wenthold73 N/A Plasmid to express PSD-95-mCherry (pCMV-PSD-95-mCherry) Gift from P. de Koninck32 N/A Plasmid to express Green-Camuia Addgene38 pCMV-REACh-CaMKIIa- mEGFP #26933 Plasmid to express SEP-g2 (pCMV-SEP-g2-GABAAR) Gift from S. Moss 74 N/A Plasmid to express Flag-GluN2A-S1462A (pCMV-Flag-GluN2A-S1462A) Gift from R. Wenthold73 N/A Plasmid to express Flag-GluN2B-S1480A (pCMV-Flag-GluN2B-S1480A) Gift from R. Wenthold73 N/A Plasmid to express SEP-GluN2A (pCMV-SEP-GluN2A) Homemade35 N/A Plasmid to express GCaMP6f (pZac2.1-GCaMP6f) Gift from B. Khakh75 N/A Plasmid to express mVenus-Gephyrin (pCMV-mVenus-Gephyrin) Gift from A. Triller76 N/A Experimental models: Organisms/strains Sprague-Dawley rats (RjHan:SD) Janvier Labs N/A Software and algorithms GraphPad Prism v8.0 GraphPad https://www.graphpad.com/ MetaMorph v7.8 Molecular Devices https://www.moleculardevices.com/ products/cellular-imaging-systems/ acquisition-and-analysis-software/ metamorph-microscopy PALMTracer Sibarita’s Lab77 https://www.iins.u-bordeaux.fr/ projectSIBARITA70 WaveTracer Sibarita’s lab78 https://www.iins.u-bordeaux.fr/ projectSIBARITA37 SR Tesseler Sibarita’s lab79 https://github.com/flevet/SR-Tesseler MatLab MathWorks https://fr.mathworks.com/ products/matlab.html ImageJ National Institutes of Health https://imagej.nih.gov/ij/download.html LI-FLIM Lambert Instruments https://www.lambertinstruments. com/liflim EthoVision XT Noldus https://www.noldus.com/ethovision-xt Other Osmotic pumps Alzet Model 2002 Forced Swim test Noldus N/A Elevated plus maze Noldus N/A Open-field arena Homemade80 N/A Panlab startle chamber Harvard Apparatus 76-0280 e2 Neuron 112, 1–18.e1–e9, October 9, 2024



    Similar Products

    neurocult sm1 without vitamin a stemcell #05731  (STEMCELL Technologies Inc)
    90
    STEMCELL Technologies Inc neurocult sm1 without vitamin a stemcell #05731
    Neurocult Sm1 Without Vitamin A Stemcell #05731, supplied by STEMCELL Technologies Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/neurocult+sm1+stemcell/neurocult+sm1+without+vitamin+a/pmc11497635-49-11-16
    Average 90 stars, based on 1 article reviews
    neurocult sm1 without vitamin a stemcell #05731 - by Bioz Stars, 2026-10
    90/100 stars
    		  Buy from Supplier
    neurocult sm1 neuronal supplement (stemcell technologies, #05711)  (STEMCELL Technologies Inc)
    90
    STEMCELL Technologies Inc neurocult sm1 neuronal supplement (stemcell technologies, #05711)
    Neurocult Sm1 Neuronal Supplement (Stemcell Technologies, #05711), supplied by STEMCELL Technologies Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/neurocult+sm1+stemcell/neurocult+sm1+neuronal+supplement/bio_rxiv__2024__08__09__607194-209-41-45
    Average 90 stars, based on 1 article reviews
    neurocult sm1 neuronal supplement (stemcell technologies, #05711) - by Bioz Stars, 2026-10
    90/100 stars
    		  Buy from Supplier
    neurocult sm1 stemcell  (STEMCELL Technologies Inc)
    90
    STEMCELL Technologies Inc neurocult sm1 stemcell
    Neurocult Sm1 Stemcell, supplied by STEMCELL Technologies Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/neurocult+sm1+stemcell/brainphys+neuronal+culture+medium/pm39047728-637-230-233
    Average 90 stars, based on 1 article reviews
    neurocult sm1 stemcell - by Bioz Stars, 2026-10
    90/100 stars
    		  Buy from Supplier
    neurocult sm1 stemcell technologies, cat# 05711  (STEMCELL Technologies Inc)
    90
    STEMCELL Technologies Inc neurocult sm1 stemcell technologies, cat# 05711
    Neurocult Sm1 Stemcell Technologies, Cat# 05711, supplied by STEMCELL Technologies Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/neurocult+sm1+stemcell/neurocult+sm1+stemcell+technologies++cat++05711/pmc10312735-47-34-37
    Average 90 stars, based on 1 article reviews
    neurocult sm1 stemcell technologies, cat# 05711 - by Bioz Stars, 2026-10
    90/100 stars
    		  Buy from Supplier
    neurocult sm1 stemcell 05711  (STEMCELL Technologies Inc)
    90
    STEMCELL Technologies Inc neurocult sm1 stemcell 05711
    Neurocult Sm1 Stemcell 05711, supplied by STEMCELL Technologies Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/neurocult+sm1+stemcell/neurocult+sm1+stemcell+05711/pm31600775-168-12-14
    Average 90 stars, based on 1 article reviews
    neurocult sm1 stemcell 05711 - by Bioz Stars, 2026-10
    90/100 stars
    		  Buy from Supplier
    neurocult sm1 stemcell #5711  (STEMCELL Technologies Inc)
    90
    STEMCELL Technologies Inc neurocult sm1 stemcell #5711
    Neurocult Sm1 Stemcell #5711, supplied by STEMCELL Technologies Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/neurocult+sm1+stemcell/neurocult+sm1+stemcell++5711/pmc07985376-283-15-17
    Average 90 stars, based on 1 article reviews
    neurocult sm1 stemcell #5711 - by Bioz Stars, 2026-10
    90/100 stars
    		  Buy from Supplier
    neurocult sm1 supplement stemcell #5711  (STEMCELL Technologies Inc)
    90
    STEMCELL Technologies Inc neurocult sm1 supplement stemcell #5711
    Neurocult Sm1 Supplement Stemcell #5711, supplied by STEMCELL Technologies Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/neurocult+sm1+stemcell/neurocult+sm1+neuronal+supplement/pmc07575210-109-12-15
    Average 90 stars, based on 1 article reviews
    neurocult sm1 supplement stemcell #5711 - by Bioz Stars, 2026-10
    90/100 stars
    		  Buy from Supplier

    Image Search Results